Mouse Anti-Silkworm CDC37 Antibody (MO-AB-69457W)


Cat: MO-AB-69457W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO69457W
SpecificityThis antibody binds to Silkworm CDC37.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDC37 (Cell Division Cycle 37) is a Protein Coding gene. Among its related pathways are Aryl Hydrocarbon Receptor and Signaling by Ligand-Responsive EGFR Variants in Cancer. Gene Ontology (GO) annotations related to this gene include protein kinase binding and kinase binding. An important paralog of this gene is CDC37L1.
Product OverviewMouse Anti-Silkworm CDC37 Antibody is a mouse antibody against CDC37. It can be used for CDC37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHSP90 cochaperone CDC37 homologue; CDC37
UniProt IDQ5CCL4
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MVDYSKWKDIEISDDEDETHPNIDTPSLFRWRHQARVERMEERRREKEELEQRKKENQRRLTETRKKISEADADSPNLNSLXKMLAELENDEKKILKRDEELRKKDKHTPWNVDTISEPGFNKTVINTKALRPSNENLTEEEKEAKMKKFIKENEKFLKQFGLLRKYEDSTKFLLDHNQLVCEETANYLVIWCINLEMEEKHDLMSHVAHQTICMQYILELSRQLDVDPRACVGSFFSKIQTAEQAYKDAFEDELKQFKIRIKKRAAEKIQEAIKEAEEEERKARLGPGGLDPVEVYEELPDELKKCFDAQDVPMLQATIAKIPQEEAIYYMNRCIASGLWVPGKNDEEPTMKDSKTEKHSGETSTNANDVD.
See other products for " CDC37 "
MO-AB-52631WMouse Anti-Marmoset CDC37 Antibody (MO-AB-52631W)
CBMOAB-69781FYAMouse Anti-Zebrafish cdc37 Antibody (CBMOAB-69781FYA)
MO-AB-25959WMouse Anti-Chimpanzee CDC37 Antibody (MO-AB-25959W)
MO-AB-02235HMouse Anti-Frog cdc37 Antibody (MO-AB-02235H)
CBMOAB-01165HCBMouse Anti-C. elegans CDC37 Antibody (CBMOAB-01165HCB)
MO-AB-01083YMouse Anti-Chicken Cdc37 Antibody (MO-AB-01083Y)
CBMOAB-38788FYAMouse Anti-Rhesus CDC37 Antibody (CBMOAB-38788FYA)
CBMOAB-00670CRMouse Anti-Yeast CDC37 Antibody (CBMOAB-00670CR)
MO-AB-09913RMouse Anti-Cattle CDC37 Antibody (MO-AB-09913R)
MO-AB-24517RMouse Anti-Pig CDC37 Antibody (MO-AB-24517R)
For Research Use Only | Not For Clinical Use.
Online Inquiry