Mouse Anti-Silkworm CSP3 Antibody (MO-AB-69562W)


Cat: MO-AB-69562W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO69562W
SpecificityThis antibody binds to Silkworm CSP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNon-catalytic caspase homolog which does not contain the region necessary for caspase activity (PubMed:9857046). Acts as an inhibitor of caspase ced-3 zymogen autoactivation and delays ced-4-induced ced-3 processing (PubMed:18776901). Has no effect on active ced-3 (PubMed:18776901). Probably by preventing ced-3 activation, protects cells, whose fate is to live, from apoptosis during embryonic and larval development (PubMed:18776901).
Product OverviewMouse Anti-Silkworm CSP3 Antibody is a mouse antibody against CSP3. It can be used for CSP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemosensory protein 14 variant; Chemosensory protein 14variant; Chemosensory protein-14; Chemosensory protein3; CSP3
UniProt IDQ3LBA1
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: MACVAVTWARPESTYTDKWDNINVDEILESNRLLKGYVDCLLGKGRCTPDGKALKETLPDALEHECVKCTGKQKSGADKVIRHLVNKRPDLWKELAVKYDPDNIYQARYKDKIDAVKGSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry