AibGenesis™ Mouse Anti-Dll Antibody (MO-AB-69716W)


Cat: MO-AB-69716W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-69716W Monoclonal Silkworm (Bombyx mori), Sea-anemone WB, ELISA MO69716W 100 µg
MO-AB-13864Y Monoclonal Sea-anemone WB, ELISA MO13864Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori), Sea-anemone
CloneMO69716W
SpecificityThis antibody binds to Silkworm Dll.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Silkworm Dll Antibody is a mouse antibody against Dll. It can be used for Dll detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDistal-less; Dll
UniProt IDB4X6Z7
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MTSQDNLDHHHLGGSQTPHDISNSANSTPTNVSKSAFIELQQHGYGPFRGGYQHPHHFGSPGGQQNPHEASGFPSPRSLGYPFPPMHQSTYGYHLGSYAPQCASPPKDGKSHVSITLNYFFTFCITRLKRPRLERRPTAITNSCIMKTSTLMSPIDIYIEVYLRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry