Mouse Anti-Silkworm Elp1 Antibody (MO-AB-69771W)


Cat: MO-AB-69771W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO69771W
SpecificityThis antibody binds to Silkworm Elp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a scaffold protein and a regulator for three different kinases involved in proinflammatory signaling. The encoded protein can bind NF-kappa-B-inducing kinase and I-kappa-B kinases through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Silkworm Elp1 Antibody is a mouse antibody against Elp1. It can be used for Elp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesElongator complex protein 1; Elp1
UniProt IDD9N4J5
Protein RefseqThe length of the protein is 1272 amino acids long.
The sequence is show below: MKNLQLWDISIRDFCVHFEEKAVICHGRGDGGSSSDIFVCGNNLILCNFDENCQKKWFKDVSEYISPENSPVNICYLSLQNSLCIGFANGELLAIGDSGVTCETVGIFNTGLLAMEWSPDQELLAIVTKEMHMVLLSCTYDPINEIKLHNQEFGEKQFITVGWGKKETQFHGSEGKQAAKIKNDIVSDDSTASDKVKITWRGDGNLYAIGFAMDGLRHFKVFDREGHLLYTSEKQKGLEDNIVWRPSGNVITTTQKIENQYKVTFFEKNGLKHREFSIPVEHGTYVENIMWSSDSEILTLQCKDTETNTQKVLLYTTSNYHWYLKQTLLFRSNQRINKIIWDNDFDISNNKKMHIILQNGSYLIYSWIWNIDHSKSNIDNDDAVVVAIDGDKLLITGFRQTVVPPPMASLEIKLESTAQAICFAPKNENVNPNSFFVITVDNKLLFYSQKEKHPLNYEAYNSQQFDKSDFPFQYHHWLWVDSQTIXCAMTDEKSTSVIELTMVNDKLVKSNSVHVRGVVTQIQAHPTNKSLLFLQFITGHIHKYNIGGFLENTNILFKVPCPRFGILPIEDSLHFIGLSHKGHLFIDNVQVLSNVSSFFIHTDFLLLTTLQHLLLCVEKNKLGLKALMEYQTNESDYVYKRKIERGAKLVIIVPNDTRTILQMPRGNIEAIQPRPLSLKIIGKYLDNLKYYEAFDLMRKQRINLNLIFDHNPKKFIANIDTFLHSIKNNSWLNLFLSDLENIXVTKTMFSSINYYAERPAVTDEISRKIDIVCEMFRAHIEKRSDKATKILPLLTTYVKKNTVDDLQKALEIIKGLKKQETSGEKIPVSSDEALKYLLYMVDVTQLFDIALGMYDFELVLLVATKSQKDPKEYIPMLNELNEMDENYKRFTINKQLKRFDKAVQSLVLCGPTRHCELKTFVKYHSLYQEALKHFSFEEEIFREISEDYGQHLKLKKYYTEAAIIYERANNNDKAIECYKEALEWELAIKLAYFWPKAQFKVLCWELVTALKEEKRHEEALIILEQFYGDPEECISYAVETSHYKKALRLCSLYDKLQLKEERILPALLEEYQNMTDLIETNRSTFLKHRERLFHVRNIKRDNPVDLYDIYTNKDADLYSDAGSTLASSSRGSSRSYRSSKNRRKHERKIASLKEGSQYEDVGLIIALHCLITSTFDLRNHVKDLTVGLICFNMDKEAFILQKALEKLLNEMKDSFKDIWTNDFMLEATNATITAHNISEGSSVLPPGIASLELHFRIPPVIQEINWKLEGLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry