Mouse Anti-Silkworm FMO2 Antibody (MO-AB-69815W)


Cat: MO-AB-69815W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO69815W
SpecificityThis antibody binds to Silkworm FMO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Silkworm FMO2 Antibody is a mouse antibody against FMO2. It can be used for FMO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFlavin-containing monooxygenase; EC 1.-.-.-; FMO2
UniProt IDD7PGZ5
Protein RefseqThe length of the protein is 450 amino acids long.
The sequence is show below: MYSRVFIFVLCIQMCLFYKIREKKRVCVIGAGIAGLSSARYLKEEGIDFVVFEATKYIGGTWRYDPRVGTDENGLPLHTSMYKHLHTNLPKPTMELRGFPLPDGIPSFPSWKIYYDYLKDYAKHFDIEKYIQFRHNVTLVRREQNVWKVTHEHVITGEVFEENYDYVIVGNGHFSTPNMPNIRGEKLFKGTIIHSHDYRVPDVYKDRRVLVVGAGPSGMDIGLDVAECSKSLLHSHHSKVNFRTPFPPHYVRKPDVKEFNETGVIFVDGTYEEIDDVIYCTGFQYDYPFLDKTCGLDIDPHSVVPLYKYMVNIRQPSMVILGLVVRACLVVALDAQARYATALIKGNFTLPSEAEMMDEWQRRADAIRSKGLRMSHIHTLAEKEDEYYAELSEQSGIERVPPVMFKIRAMDIEAKLENLYTYRHYVYKVIDDNTFVRTLEKEQINDTLVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry