Mouse Anti-Silkworm RAD51 Antibody (MO-AB-70280W)


Cat: MO-AB-70280W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO70280W
SpecificityThis antibody binds to Silkworm RAD51.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Silkworm RAD51 Antibody is a mouse antibody against RAD51. It can be used for RAD51 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRad51 homolog; RAD51
UniProt IDO01679
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MNTTASATTTSVDEDADECGPQLISKLEGNGITSGDIKKLEEAGYHTVESVAYAPKKWLITIKGISEAKADKILAEASKLVPMGFTTATEFHQKRAEIIQLTTGSKELDRLLGGGIETGSITEIFGEFRTGKTQLCHTLAVTCQLPIEQSGGEGKCMYIDTEGTFRPERLLAVAQRYGMEGAAVLDNVAYARAYNTDHQTQLLVQACAMMAESRYSLIIVDSATALYRTDYSGRGELNSRQLHLGRFMRMLLRLADEFGVAVIITNQVVAQVDSVGVFNADTKKPIGGHIIAHASTTRLYLRKGRGDNRVCKIYDSPCLPETEAMFAISAEGITDAKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry