Mouse Anti-Silkworm RpS3 Antibody (MO-AB-70355W)
Cat: MO-AB-70355W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Silkworm (Bombyx mori) |
Clone | MO70355W |
Specificity | This antibody binds to Silkworm RpS3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit, where it forms part of the domain where translation is initiated. The protein belongs to the S3P family of ribosomal proteins. Studies of the mouse and rat proteins have demonstrated that the protein has an extraribosomal role as an endonuclease involved in the repair of UV-induced DNA damage. The protein appears to be located in both the cytoplasm and nucleus but not in the nucleolus. Higher levels of expression of this gene in colon adenocarcinomas and adenomatous polyps compared to adjacent normal colonic mucosa have been observed. This gene is co-transcribed with the small nucleolar RNA genes U15A and U15B, which are located in its first and fifth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Silkworm RpS3 Antibody is a mouse antibody against RpS3. It can be used for RpS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribosomal protein S3; RpS3 |
UniProt ID | Q5UAP2 |
Protein Refseq | The length of the protein is 243 amino acids long. The sequence is show below: MAVNNISKKRKFVGDGVFKAELNEFLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLGEKGRRIRELTSVVQKRFNIPEQSVELYAEKVATRGLCAIAQAESLRYKLIGGLAVRRACYGVLRFIMESGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEPTSEVRSLAPAPLPQPVAAVA. |
See other products for " RPS3 "
MO-AB-19572R | Mouse Anti-Cattle RPS3 Antibody (MO-AB-19572R) |
MO-MMB-0449 | Rabbit Anti-rps3 Antibody (Cat MO-MMB-0449) |
CBMOAB-03627CR | Mouse Anti-Yeast RPS3 Antibody (CBMOAB-03627CR) |
MO-AB-32496H | Mouse Anti-Soybean rps3 Antibody (MO-AB-32496H) |
CBMOAB-40716FYC | Mouse Anti-Arabidopsis RPS3 Antibody (CBMOAB-40716FYC) |
MO-AB-16852H | Mouse Anti-Malaria parasite rps3 Antibody (MO-AB-16852H) |
MO-AB-35161H | Mouse Anti-Tomato rps3 Antibody (MO-AB-35161H) |
MO-AB-28675H | Mouse Anti-Rat Rps3 Antibody (MO-AB-28675H) |
MO-AB-00568W | Mouse Anti-Barrel medic rps3 Antibody (MO-AB-00568W) |
CBMOAB-89244FYB | Mouse Anti-Rice rps3 Antibody (CBMOAB-89244FYB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry