Mouse Anti-sirt2 Antibody (CBMOAB-05413FYB)
Cat: CBMOAB-05413FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-05413FYB | Monoclonal | Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO05413FYB | 100 µg | ||
CBMOAB-31124FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO31124FYA | 100 µg | ||
CBMOAB-57813FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO57813FYA | 100 µg | ||
MO-AB-03975Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03975Y | 100 µg | ||
MO-AB-05986W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05986W | 100 µg | ||
MO-AB-07639H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07639C | 100 µg | ||
MO-AB-11773W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11773W | 100 µg | ||
MO-AB-20147R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20147R | 100 µg | ||
MO-AB-29104R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO29104R | 100 µg | ||
MO-AB-33327W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33327W | 100 µg | ||
MO-AB-64404W | Monoclonal | Marmoset | WB, ELISA | MO64404W | 100 µg | ||
MO-DKB-00410W | Polyclonal | C. elegans (Caenorhabditis elegans) | WB, IHC, IHC-P, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) |
Clone | MO05413FYB |
Specificity | This antibody binds to Zebrafish sirt2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Cytoskeleton; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene. |
Product Overview | Mouse Anti-Zebrafish sirt2 Antibody is a mouse antibody against sirt2. It can be used for sirt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | NAD-dependent protein deacetylase sirtuin-2; EC 3.5.1.-; Regulatory protein SIR2 homolog 2; SIR2-like protein 2; sirt |
UniProt ID | Q7ZVK3 |
Protein Refseq | The length of the protein is 379 amino acids long. The sequence is show below: MSEEVSKRVEEEADTPGLEGQSDDSSDEGDASGDTEMDFLRSLFSRTLGLSPGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYPGQFKPTVYHYFIKMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMKNQIFSEEIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSRVSNRCPRLLINMEKTGQSEFGMGLFSFGGGMDFDSDKAYRDVAHLSTCDDGCMTLAELLGWKKELEEMVKREHALIDSKDAKKTDKEASQSSKSAVAEAEKTDKTE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry