Mouse Anti-sirt2 Antibody (CBMOAB-05413FYB)


Cat: CBMOAB-05413FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05413FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO05413FYB 100 µg
CBMOAB-31124FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO31124FYA 100 µg
CBMOAB-57813FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57813FYA 100 µg
MO-AB-03975Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03975Y 100 µg
MO-AB-05986W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05986W 100 µg
MO-AB-07639H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07639C 100 µg
MO-AB-11773W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11773W 100 µg
MO-AB-20147R Monoclonal Cattle (Bos taurus) WB, ELISA MO20147R 100 µg
MO-AB-29104R Monoclonal Pig (Sus scrofa) WB, ELISA MO29104R 100 µg
MO-AB-33327W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33327W 100 µg
MO-AB-64404W Monoclonal Marmoset WB, ELISA MO64404W 100 µg
MO-DKB-00410W Polyclonal C. elegans (Caenorhabditis elegans) WB, IHC, IHC-P, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO05413FYB
SpecificityThis antibody binds to Zebrafish sirt2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.
Product OverviewMouse Anti-Zebrafish sirt2 Antibody is a mouse antibody against sirt2. It can be used for sirt2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAD-dependent protein deacetylase sirtuin-2; EC 3.5.1.-; Regulatory protein SIR2 homolog 2; SIR2-like protein 2; sirt
UniProt IDQ7ZVK3
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: MSEEVSKRVEEEADTPGLEGQSDDSSDEGDASGDTEMDFLRSLFSRTLGLSPGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYPGQFKPTVYHYFIKMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMKNQIFSEEIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSRVSNRCPRLLINMEKTGQSEFGMGLFSFGGGMDFDSDKAYRDVAHLSTCDDGCMTLAELLGWKKELEEMVKREHALIDSKDAKKTDKEASQSSKSAVAEAEKTDKTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry