Mouse Anti-sirt3 Antibody (CBMOAB-05414FYB)
Cat: CBMOAB-05414FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-05414FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) | WB, ELISA | MO05414FYB | 100 µg | ||
| CBMOAB-57814FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO57814FYA | 100 µg | ||
| MO-AB-05987W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05987W | 100 µg | ||
| MO-AB-08062W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08062W | 100 µg | ||
| MO-AB-09920Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09920Y | 100 µg | ||
| MO-AB-11983W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11983W | 100 µg | ||
| MO-AB-20149R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20149R | 100 µg | ||
| MO-AB-29105R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO29105R | 100 µg | ||
| MO-AB-64406W | Monoclonal | Marmoset | WB, ELISA | MO64406W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) |
| Clone | MO05414FYB |
| Specificity | This antibody binds to Zebrafish sirt3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. |
| Product Overview | Mouse Anti-Zebrafish sirt3 Antibody is a mouse antibody against sirt3. It can be used for sirt3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Sirtuin (Silent mating type information regulation 2 homolog) 3; S. cerevisiae; sirt |
| UniProt ID | A1L2B7 |
| Protein Refseq | The length of the protein is 357 amino acids long. The sequence is show below: MLYLNTFLPSVCRRCFAENLLWRRGLTTTQNLSRTKLVHQKTLSHFPHAQKGAAFLSQFIYCPAAFIKCGGTRGLFGGGRDNVHQQTLEDIAEKIRERKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYNLPYAEAIFEINYFHHNPNPFFALAKELYPGNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRDDIMAGTVPKCPTCKGIIKPDIVFFGEELPQHFFTYLTDFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRHTDVAELGDVVNGVKKLVELLGWKQELEDLMNVGRDK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry