Mouse Anti-six3b Antibody (CBMOAB-05433FYB)


Cat: CBMOAB-05433FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05433FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO05433FYB 100 µg
MO-DKB-03932W Polyclonal Zebrafish (Danio rerio) Pep-ELISA 100 µg
MO-MMB-0586 Polyclonal Zebrafish (Danio rerio) IA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO05433FYB
SpecificityThis antibody binds to Zebrafish six3b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish six3b Antibody is a mouse antibody against six3b. It can be used for six3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein Six6; Sine oculis homeobox homolog 3b; Six3; six3b; six3 six
UniProt IDO73709
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: MVFRSPLELYPSHLFLPNFADRPLLLAGSIPRARSPEDLPMFQLPTLNFSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACDAINKHESIQRARAVVAYHTGSFRELYHILETHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHHGLGQSSLRSMSESGCTPHSSAESPCAAASPTTSVSSMNERGDGGTILSVTDSDSDFDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry