Mouse Anti-slc25a12 Antibody (CBMOAB-05716FYB)


Cat: CBMOAB-05716FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05716FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO05716FYB 100 µg
CBMOAB-58028FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58028FYA 100 µg
MO-AB-07691H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07691C 100 µg
MO-AB-14283W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14283W 100 µg
MO-AB-20280R Monoclonal Cattle (Bos taurus) WB, ELISA MO20280R 100 µg
MO-AB-30069R Monoclonal Pig (Sus scrofa) WB, ELISA MO30069R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO05716FYB
SpecificityThis antibody binds to Zebrafish slc25a12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in this gene may be associated with autism, and mutations in this gene may also be a cause of global cerebral hypomyelination. Alternatively spliced transcript variants have been observed for this gene.
Product OverviewMouse Anti-Zebrafish slc25a12 Antibody is a mouse antibody against slc25a12. It can be used for slc25a12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesslc25a12; Solute Carrier Family 25 Member 12
UniProt IDF1R0G9
Protein RefseqThe length of the protein is 714 amino acids long.
The sequence is show below: MRAHLLALFTRFLSPRPRACATPRPHVTSDSSMAAKVQLTKRADPNDLKVIFQKYASVVDKDGERYMTPIDFVQRYLGLHTQLHFNPKTVHLLAGVADTTKDGLISYQEFLAFESVLCMPDALFIVAFQLFDKTGTGDVSFENVRDIFSQTTVHHHIPFNWDCEFIRLHFGNARNKRLSYLEFGQFLQELQLEHARQAFVQKDKVKSGMISSLDFSDIMSTIRHHMLTPFVEENLVSAAGGGTSHMVSFSYFNAFNSLLNNMEMIRKIYSTLAGSRKDTLVTKEEFVHAANKFGQITPMEIDILFQLSGLHSQTGRLNMTDIERIAPLEEGSLPYNVAEAQRQHSHGEVSRPVWLQAAESAYRFTLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFFGFYRGLLPQLIGVAPEKAIKLTVNDFVRDKFTTNDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVIRDLGFFGLYKGAKACFLRDIPFSAIYFPVYAHTKALLADEDGRLGALQLLSAGAIAGVPAASLVTPADVIKTRLQVAARAGQTTYNGVIDCFRKIMKEEGFRALWKGAGARVFRSSPQFAVTLLTYELLQRWLYVDFGGHRPAGSEPTPKSRISELPPVSSEHVGGYRLAAATFAGVENKFGLHLPKFKSSGISTIHPETPKETAGAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry