Mouse Anti-SLC25A41 Antibody (CBMOAB-58069FYA)


Cat: CBMOAB-58069FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58069FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO58069FYA 100 µg
MO-AB-20312R Monoclonal Cattle (Bos taurus) WB, ELISA MO20312R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO58069FYA
SpecificityThis antibody binds to Rhesus SLC25A41.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SLC25A41 Antibody is a mouse antibody against SLC25A41. It can be used for SLC25A41 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC25A41
UniProt IDF6WDP1
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCGIHGSPPFQERLLAGSLAVAISQTLINPMEVLKTRLTLRRTGQYKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQCFWLKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQDTVEGSNPTMRGVLQRILAQQGWLGLYRGMTPTLLKVLPAGGISYVVYEAMKKTLGV.
For Research Use Only | Not For Clinical Use.
Online Inquiry