AibGenesis™ Mouse Anti-SLC25A45 Antibody (CBMOAB-58075FYA)


Cat: CBMOAB-58075FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58075FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO58075FYA 100 µg
MO-AB-06045W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06045W 100 µg
MO-AB-21972W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21972W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO58075FYA
SpecificityThis antibody binds to Rhesus SLC25A45.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SLC25A45 Antibody is a mouse antibody against SLC25A45. It can be used for SLC25A45 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC25A45
UniProt IDF7FBF2
Protein RefseqThe length of the protein is 333 amino acids long.
The sequence is show below: MPVEEFVAGWISGALGLVLGHPFDTVKLLGFFKGMSFPIASIAVVNSVLFGVYSNTLLLLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPVAQPGSPPPQYQGPVHCAASIFREEGYRGLFRGAWALMLRDTPTMGIYFITYEGLCHQYTPEGQNPSSATVLVAGGCRHCFLGGSHALRRDQVPDADGRAETQSIPGGAGLHGEQRPAGRTGGLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPMAPHQAHGPEASLRLEARLKACKSVQEAQPFLTKAPPTRADLGWAGACRSQKPGGAASLCSWP.
For Research Use Only | Not For Clinical Use.
Online Inquiry