Mouse Anti-slc35a2 Antibody (CBMOAB-05941FYB)


Cat: CBMOAB-05941FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05941FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO05941FYB 100 µg
CBMOAB-58163FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58163FYA 100 µg
MO-AB-07743H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07743C 100 µg
MO-AB-11210W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11210W 100 µg
MO-AB-20379R Monoclonal Cattle (Bos taurus) WB, ELISA MO20379R 100 µg
MO-AB-33374W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33374W 100 µg
MO-AB-64619W Monoclonal Marmoset WB, ELISA MO64619W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO05941FYB
SpecificityThis antibody binds to Zebrafish slc35a2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nucleotide-sugar transporter family. The encoded protein is a multi-pass membrane protein. It transports UDP-galactose from the cytosol into Golgi vesicles, where it serves as a glycosyl donor for the generation of glycans. Mutations in this gene cause congenital disorder of glycosylation type IIm (CDG2M). Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish slc35a2 Antibody is a mouse antibody against slc35a2. It can be used for slc35a2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel protein similar to vertebrate UDP-galactose transporters; slc35a
UniProt IDQ8JFW8
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: VNKKLKYTSLAILVIQNASLILSIRYVRTLPGDHFYTTSAVVMAEVLKVITCLFIILIQKRGSVKSFVSLLYDSIVIQYWDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLRKSLSRIQWISLVLLFAGVAIVQVEQESGKQKEAVTAANQNYFKGLLSVIISCLSSGFAGVYFEKILKGSSASVWMRNIQLGIFGTVLGLLGMWWNDGAAIAEKGFLFGYTPMVWGVIFNQAFGGLLVAVVVKYADNILKGFATSFSIIVSTITSVYLFGFHVDLVFTLGAGLVIGAVYMYSLPKANTSTSSTSTASSSKAGESELDAFLPKSVLVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry