Mouse Anti-slc35a2 Antibody (CBMOAB-05941FYB)
Cat: CBMOAB-05941FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-05941FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO05941FYB | 100 µg | ||
| CBMOAB-58163FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO58163FYA | 100 µg | ||
| MO-AB-07743H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07743C | 100 µg | ||
| MO-AB-11210W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11210W | 100 µg | ||
| MO-AB-20379R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20379R | 100 µg | ||
| MO-AB-33374W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33374W | 100 µg | ||
| MO-AB-64619W | Monoclonal | Marmoset | WB, ELISA | MO64619W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO05941FYB |
| Specificity | This antibody binds to Zebrafish slc35a2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the nucleotide-sugar transporter family. The encoded protein is a multi-pass membrane protein. It transports UDP-galactose from the cytosol into Golgi vesicles, where it serves as a glycosyl donor for the generation of glycans. Mutations in this gene cause congenital disorder of glycosylation type IIm (CDG2M). Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish slc35a2 Antibody is a mouse antibody against slc35a2. It can be used for slc35a2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Novel protein similar to vertebrate UDP-galactose transporters; slc35a |
| UniProt ID | Q8JFW8 |
| Protein Refseq | The length of the protein is 347 amino acids long. The sequence is show below: VNKKLKYTSLAILVIQNASLILSIRYVRTLPGDHFYTTSAVVMAEVLKVITCLFIILIQKRGSVKSFVSLLYDSIVIQYWDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLRKSLSRIQWISLVLLFAGVAIVQVEQESGKQKEAVTAANQNYFKGLLSVIISCLSSGFAGVYFEKILKGSSASVWMRNIQLGIFGTVLGLLGMWWNDGAAIAEKGFLFGYTPMVWGVIFNQAFGGLLVAVVVKYADNILKGFATSFSIIVSTITSVYLFGFHVDLVFTLGAGLVIGAVYMYSLPKANTSTSSTSTASSSKAGESELDAFLPKSVLVK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry