AibGenesis™ Mouse Anti-SLC35G1 Antibody (CBMOAB-58202FYA)


Cat: CBMOAB-58202FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58202FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO58202FYA 100 µg
MO-AB-20396R Monoclonal Cattle (Bos taurus) WB, ELISA MO20396R 100 µg
MO-AB-22823W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22823W 100 µg
MO-AB-64645W Monoclonal Marmoset WB, ELISA MO64645W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO58202FYA
SpecificityThis antibody binds to Rhesus SLC35G1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane protein which is a member of the drug/metabolite transporter protein superfamily. The encoded protein may play a role in the regulation of calcium levels inside the cell. (From NCBI)
Product OverviewMouse Anti-Rhesus SLC35G1 Antibody is a mouse antibody against SLC35G1. It can be used for SLC35G1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSLC35G1
UniProt IDF7GUZ5
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: MRPQDSAGAVELEKVGLPLTDDAPPGASEEPAAAEAAGAPDSGRCWLCLSSPCCSRTEPAKKKAPCPGLGLFYTLLSAFCFSVSSLLVKKVQDVHAVEISAFRCVLQMLIVLPCLIYRKTGFIGPKSHRIFLILRGVLGSTSMMLIYYAFQTMALADATVITFSSPVFTSIFAWICLKEKYSPWDALFTMFTIAGVILIVRPPFLFGSLGIEESYSVHLKGTFAAIGHAVFAASTLVILRKMGKSVDYFLTIWYYVVLGLVETVIILFILGEWSLPYCGLDRLFLIFIALFGLGAQIFITKALQIEKAGPVAIMRTMDVVFAFIFQIIFFNNVPTWWTVGGAVCVVASNVGAAVRKWYQSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry