Mouse Anti-slc39a7 Antibody (CBMOAB-06050FYB)


Cat: CBMOAB-06050FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06050FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO06050FYB 100 µg
CBMOAB-58242FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58242FYA 100 µg
MO-AB-07758H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07758C 100 µg
MO-AB-13338W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13338W 100 µg
MO-AB-20424R Monoclonal Cattle (Bos taurus) WB, ELISA MO20424R 100 µg
MO-AB-30155R Monoclonal Pig (Sus scrofa) WB, ELISA MO30155R 100 µg
MO-AB-33380W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33380W 100 µg
MO-AB-64677W Monoclonal Marmoset WB, ELISA MO64677W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO06050FYB
SpecificityThis antibody binds to Zebrafish slc39a7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of the encoded protein could be useful as a therapeutic agent against cancer. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish slc39a7 Antibody is a mouse antibody against slc39a7. It can be used for slc39a7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc transporter; slc39a7; ke
UniProt IDQ7T1M5
Protein RefseqThe length of the protein is 444 amino acids long.
The sequence is show below: MRVFSKSLLLIAVGILMSQQTLAHSHHHHGHGDGGCHGHSHGGAKMHHGASKWSAEANLPHAEEEHHVHDHGHTHDHAHDHGHAHSHGDIHDHGHAHKHGHAHDHGAEKSKKVVEAGKRNMVELWMQAIGATLLISAAPFLILFLIPVQSNTDQHQNLLKVLLSFASGGLLGDAFLHLIPHALEPHSHHSQPHSEESHGQSHGEESHGHSHGAAHGHMMSVGLWVLGGIVAFLVVEKFVRLLKGGHSHSHSHSPSAPKSKDSDEEDDKKGQKKGEKDKVVSQQKPTKKTVETSSDIKVSGYLNLAADFTHNFTDGLAIGASFLVGPAVGAVTTITILLHEVPHEIGDFAILVQSGCTKRKAMCLQLLTAVGALAGTACSLLAEGVGDATTAWILPFTAGGFVYIAAVTVLPELLAGHSSFWQSLLEILALLFGVGMMVLIAEYE.
For Research Use Only | Not For Clinical Use.
Online Inquiry