AibGenesis™ Mouse Anti-slc39a9 Antibody (CBMOAB-06053FYB)


Cat: CBMOAB-06053FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06053FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO06053FYB 100 µg
CBMOAB-58243FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58243FYA 100 µg
MO-AB-14683W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14683W 100 µg
MO-AB-20425R Monoclonal Cattle (Bos taurus) WB, ELISA MO20425R 100 µg
MO-AB-30157R Monoclonal Pig (Sus scrofa) WB, ELISA MO30157R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO06053FYB
SpecificityThis antibody binds to Zebrafish slc39a9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish slc39a9 Antibody is a mouse antibody against slc39a9. It can be used for slc39a9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9; slc39a9; zip
UniProt IDQ5BL29
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MDDFSSISLLSLSMLIGCYVAGTIPLAVNFSEEKLKLVTVLGAGLLCGTALAVIIPEGVHALYEEMLEGVHNHGHGQVEAEVSEQKVAEGVVRPSGEHGHGHEQLHAYIGISLVLGFVFMLLVDQIGSAHMHSSDDPEAARAASSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVLAMVTYVGLSQSSKEALSDVNATGVAMLFSAGTFLYVATVHVLPEVGGMGGHSHSPGGSAGKGLSKLEVGALVLGCLIPLVLSIGHQH.
For Research Use Only | Not For Clinical Use.
Online Inquiry