Mouse Anti-slc39a9 Antibody (CBMOAB-06053FYB)
Cat: CBMOAB-06053FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06053FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO06053FYB | 100 µg | ||
| CBMOAB-58243FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO58243FYA | 100 µg | ||
| MO-AB-14683W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14683W | 100 µg | ||
| MO-AB-20425R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20425R | 100 µg | ||
| MO-AB-30157R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30157R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
| Clone | MO06053FYB |
| Specificity | This antibody binds to Zebrafish slc39a9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish slc39a9 Antibody is a mouse antibody against slc39a9. It can be used for slc39a9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9; slc39a9; zip |
| UniProt ID | Q5BL29 |
| Protein Refseq | The length of the protein is 309 amino acids long. The sequence is show below: MDDFSSISLLSLSMLIGCYVAGTIPLAVNFSEEKLKLVTVLGAGLLCGTALAVIIPEGVHALYEEMLEGVHNHGHGQVEAEVSEQKVAEGVVRPSGEHGHGHEQLHAYIGISLVLGFVFMLLVDQIGSAHMHSSDDPEAARAASSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVLAMVTYVGLSQSSKEALSDVNATGVAMLFSAGTFLYVATVHVLPEVGGMGGHSHSPGGSAGKGLSKLEVGALVLGCLIPLVLSIGHQH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry