Mouse Anti-slc7a9 Antibody (CBMOAB-06256FYB)


Cat: CBMOAB-06256FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06256FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO06256FYB 100 µg
Inquiry
CBMOAB-58392FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58392FYA 100 µg
Inquiry
MO-AB-07792H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07792C 100 µg
Inquiry
MO-AB-10012Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10012Y 100 µg
Inquiry
MO-AB-20511R Monoclonal Cattle (Bos taurus) WB, ELISA MO20511R 100 µg
Inquiry
MO-AB-23734H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23734C 100 µg
Inquiry
MO-AB-30213R Monoclonal Pig (Sus scrofa) WB, ELISA MO30213R 100 µg
Inquiry
MO-AB-33415W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33415W 100 µg
Inquiry
MO-AB-38196W Monoclonal Goat (Capra hircus) WB, ELISA MO38196W 100 µg
Inquiry
MO-AB-46582W Monoclonal Horse (Equus caballus) WB, ELISA MO46582W 100 µg
Inquiry
MO-AB-64780W Monoclonal Marmoset WB, ELISA MO64780W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO06256FYB
SpecificityThis antibody binds to Zebrafish slc7a9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Alternate transcript variants, which encode the same protein, have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish slc7a9 Antibody is a mouse antibody against slc7a9. It can be used for slc7a9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesslc7a9; Solute Carrier Family 7 Member 9
UniProt IDX1WEN7
Protein RefseqThe length of the protein is 494 amino acids long.
The sequence is show below: TMEEDLKKTKANNGSVSRAVEAKNPDQPKAAVLHQDVGLLSGICLIVGTMIGSGIFISPKAVLEGTGAVGPCLCVWAACGVLATLAGALCYAELGTMIIKSGGEYPYLMEGFGPVLAYLYSWTTIIVLKPSSFAIIALSCAEYASTPFYPGCTPPQVVTKCLAAACILIITLVNCLSVKLAYRVQNFFTAAKLLIIIIIVVSGIVMLAQGNTQNLRDPFAGATTSFGAIGLAFYNGLWAYDGWNQLNFITEELKNPYKNLPLAIIIGIPLVTVCYIMVNIAYFSVMTSTELLQSSAVAVTFGDRVLYPLSWIVPVFVVCSTFGAANGSCFTAGRLTYVAGREGHMVKIMSYISVKRYTPSPALMFNGIVSIIYIMPTDINTLINYFSFATWLFYGLTCLALIVMRFTRKDLKRPVKVPIVIPALVVVVSCYLVLAPIIDKPEWEYLYCTMFIVGGLLLYVPFIHYKFNWTRRLMRPFTMHLQLLLQVVPPEKIE.
For Research Use Only | Not For Clinical Use.
Online Inquiry