AibGenesis™ Mouse Anti-SMAP1 Antibody (CBMOAB-41518FYC)


Cat: CBMOAB-41518FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41518FYC Monoclonal A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO41518FC 100 µg
CBMOAB-06411FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO06411FYB 100 µg
MO-AB-14141W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14141W 100 µg
MO-AB-64857W Monoclonal Marmoset WB, ELISA MO64857W 100 µg
MO-AB-07824H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07824C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO41518FC
SpecificityThis antibody binds to Arabidopsis SMAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Arabidopsis SMAP1 Antibody is a mouse antibody against SMAP1. It can be used for SMAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall ArfGAP 1; Stromal Membrane-Associated GTPase-Activating Protein 1; Stromal Membrane-Associated Protein 1; SMAP-1
UniProt IDQ9T0H2
Protein RefseqThe length of the protein is 62 amino acids long. The sequence is show below: MRPMQLDMLSEMDDAGSSMAMDVDDLEAMEILNEGGLVSDNKLADADFFNKFDDDFDDTDIN.
See other products for " SMAP1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry