Mouse Anti-SMAP1 Antibody (CBMOAB-41518FYC)
Cat: CBMOAB-41518FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41518FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO41518FC | 100 µg | ||
| CBMOAB-06411FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO06411FYB | 100 µg | ||
| MO-AB-14141W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14141W | 100 µg | ||
| MO-AB-64857W | Monoclonal | Marmoset | WB, ELISA | MO64857W | 100 µg | ||
| MO-AB-07824H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07824C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO41518FC |
| Specificity | This antibody binds to Arabidopsis SMAP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. |
| Product Overview | Mouse Anti-Arabidopsis SMAP1 Antibody is a mouse antibody against SMAP1. It can be used for SMAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Small ArfGAP 1; Stromal Membrane-Associated GTPase-Activating Protein 1; Stromal Membrane-Associated Protein 1; SMAP-1 |
| UniProt ID | Q9T0H2 |
| Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: MRPMQLDMLSEMDDAGSSMAMDVDDLEAMEILNEGGLVSDNKLADADFFNKFDDDFDDTDIN. |
See other products for " SMAP1 "
| MO-AB-33448W | Mouse Anti-SMAP1 Antibody (MO-AB-33448W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry