Mouse Anti-smoc2 Antibody (CBMOAB-06539FYB)


Cat: CBMOAB-06539FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06539FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO06539FYB 100 µg
MO-AB-06148W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06148W 100 µg
MO-AB-19964W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19964W 100 µg
MO-AB-20616R Monoclonal Cattle (Bos taurus) WB, ELISA MO20616R 100 µg
MO-AB-33458W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33458W 100 µg
MO-AB-64935W Monoclonal Marmoset WB, ELISA MO64935W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rhesus (Macaca mulatta)
CloneMO06539FYB
SpecificityThis antibody binds to Zebrafish smoc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the SPARC family (secreted protein acidic and rich in cysteine/osteonectin/BM-40), which are highly expressed during embryogenesis and wound healing. The gene product is a matricellular protein which promotes matrix assembly and can stimulate endothelial cell proliferation and migration, as well as angiogenic activity. Associated with pulmonary function, this secretory gene product contains a Kazal domain, two thymoglobulin type-1 domains, and two EF-hand calcium-binding domains. The encoded protein may serve as a target for controlling angiogenesis in tumor growth and myocardial ischemia. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish smoc2 Antibody is a mouse antibody against smoc2. It can be used for smoc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSecreted modular calcium-binding protein 2; smoc
UniProt IDG9LQV9
Protein RefseqThe length of the protein is 437 amino acids long.
The sequence is show below: MRVSVLLLLCALYAGNAHKLSALTFLRVEQDKECNTDCSGAPRKPLCASDGRTFSSRCEFLRAKCRDPQLAVSRGQCKDTPKCVAEKKYTEQQAKKLFPQVFVPVCNPDGTYSEVQCHSYTGYCWCVMPNGRPISGSAVANKKPQCQGSKNSKVNPKEPGKSDPSTVLVVESQPSVDEEDIISQYPTLWSEQVRSRQNRTRTQSTSCDQEQLSAQEEARQHKNEAVFVPDCASGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRHEQPKCDGNARAHPNKPKDHYRSRHLQGCPGEKKTEFLTSVLDALSTDMVHAVTDPAAGGRMLEPDPSHTLEERVVHWYFSQLDKNSSGDIGKKEIKPFKRLLRKKSKPKKCVKKFVEYCDISNDKALSLQELMGCLGVTKEEGESHCFLRWAKTGDGTTSSKLNLSKKQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry