Mouse Anti-snai2 Antibody (CBMOAB-06641FYB)


Cat: CBMOAB-06641FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06641FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO06641FYB 100 µg
MO-AB-07857H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07857C 100 µg
MO-AB-17734Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17734Y 100 µg
MO-AB-20638R Monoclonal Cattle (Bos taurus) WB, ELISA MO20638R 100 µg
MO-AB-21825W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21825W 100 µg
MO-AB-30268R Monoclonal Pig (Sus scrofa) WB, ELISA MO30268R 100 µg
MO-AB-34300W Monoclonal Donkey (Equus asinus) WB, ELISA MO34300W 100 µg
MO-AB-46622W Monoclonal Horse (Equus caballus) WB, ELISA MO46622W 100 µg
MO-AB-64964W Monoclonal Marmoset WB, ELISA MO64964W 100 µg
MO-DKB-03597W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA, FC, IHC-P, IHC-Fr, IF, ICC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO06641FYB
SpecificityThis antibody binds to Zebrafish snai2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. (From NCBI)
Product OverviewMouse Anti-Zebrafish snai2 Antibody is a mouse antibody against snai2. It can be used for snai2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSnail homolog 2; Drosophila; snai
UniProt IDQ5PQY5
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MPRSFLVKKHFNAAKKPNYSELESPTVFISPYVLKALPVPVIPQPEVLSPVAYNPITVWTTSNLPLSPLPHDLSPISGYPSSLSDTSSNKDHSGSESPRSDEDERIQSTKLSDAEKFQCGLCNKSYSTYSGLMKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKMCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCIAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry