Mouse Anti-snai2 Antibody (CBMOAB-06641FYB)
Cat: CBMOAB-06641FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-06641FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO06641FYB | 100 µg | ||
| MO-AB-07857H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07857C | 100 µg | ||
| MO-AB-17734Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17734Y | 100 µg | ||
| MO-AB-20638R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20638R | 100 µg | ||
| MO-AB-21825W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21825W | 100 µg | ||
| MO-AB-30268R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30268R | 100 µg | ||
| MO-AB-34300W | Monoclonal | Donkey (Equus asinus) | WB, ELISA | MO34300W | 100 µg | ||
| MO-AB-46622W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46622W | 100 µg | ||
| MO-AB-64964W | Monoclonal | Marmoset | WB, ELISA | MO64964W | 100 µg | ||
| MO-DKB-03597W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA, FC, IHC-P, IHC-Fr, IF, ICC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Donkey (Equus asinus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) |
| Clone | MO06641FYB |
| Specificity | This antibody binds to Zebrafish snai2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. |
| Product Overview | Mouse Anti-Zebrafish snai2 Antibody is a mouse antibody against snai2. It can be used for snai2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Snail homolog 2; Drosophila; snai |
| UniProt ID | Q5PQY5 |
| Protein Refseq | The length of the protein is 257 amino acids long. The sequence is show below: MPRSFLVKKHFNAAKKPNYSELESPTVFISPYVLKALPVPVIPQPEVLSPVAYNPITVWTTSNLPLSPLPHDLSPISGYPSSLSDTSSNKDHSGSESPRSDEDERIQSTKLSDAEKFQCGLCNKSYSTYSGLMKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKMCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCIAH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry