Mouse Anti-SNCB Antibody (MO-AB-10046Y)
Cat: MO-AB-10046Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-10046Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO10046Y | 100 µg | ||
| CBMOAB-06666FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO06666FYB | 100 µg | ||
| MO-AB-08239W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08239W | 100 µg | ||
| MO-AB-15466W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15466W | 100 µg | ||
| MO-AB-33467W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33467W | 100 µg | ||
| MO-AB-35731W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35731W | 100 µg | ||
| MO-AB-64987W | Monoclonal | Marmoset | WB, ELISA | MO64987W | 100 µg | ||
| MO-AB-20655R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20655R | 100 µg | ||
| MO-AB-30277R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30277R | 100 µg | ||
| MO-AB-29062H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29062C | 100 µg | ||
| MO-AB-33812H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33812C | 100 µg | ||
| MO-AB-01434L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01434L | 100 µg | ||
| MO-AB-04074Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04074Y | 100 µg | ||
| MO-AB-17740Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17740Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO10046Y |
| Specificity | This antibody binds to Rabbit SNCB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | This product is a mouse antibody against SNCB. It can be used for SNCB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Beta-synuclein; SNCB |
| UniProt ID | G1SHQ6 |
| Protein Refseq | The length of the protein is 134 amino acids long. The sequence is show below: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEEPPQEDYQEYEPEA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry