Mouse Anti-snrnp25 Antibody (CBMOAB-06699FYB)


Cat: CBMOAB-06699FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06699FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO06699FYB 100 µg
CBMOAB-41571FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO41571FC 100 µg
CBMOAB-58626FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58626FYA 100 µg
MO-AB-07879H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07879C 100 µg
MO-AB-15467W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15467W 100 µg
MO-AB-20661R Monoclonal Cattle (Bos taurus) WB, ELISA MO20661R 100 µg
MO-AB-29069H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29069C 100 µg
MO-AB-38203W Monoclonal Goat (Capra hircus) WB, ELISA MO38203W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO06699FYB
SpecificityThis antibody binds to Zebrafish snrnp25.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTwo types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome.
Product OverviewMouse Anti-Zebrafish snrnp25 Antibody is a mouse antibody against snrnp25. It can be used for snrnp25 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:112000; snrnp2
UniProt IDQ567J5
Protein RefseqThe length of the protein is 173 amino acids long.
The sequence is show below: MDEIKDETELKKELEEKTVEDEIKEEHEEEEDEEALPHSEILDIFEEGLALIVQDPLLCDLPIQVTLEEVNSQVALEYGQAMTVRVCKADGEVMPIVVVQSATVLDLKKAIRRYMELKQQREGGVKHVSWKYVWRTFHLVFNGEKLEDDRRKLKDYGVRNRDEVTFSKKLRKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry