Mouse Anti-snrnp40 Antibody (CBMOAB-06702FYB)


Cat: CBMOAB-06702FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06702FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset WB, ELISA MO06702FYB 100 µg
MO-AB-07881H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07881C 100 µg
MO-AB-18778W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18778W 100 µg
MO-AB-20664R Monoclonal Cattle (Bos taurus) WB, ELISA MO20664R 100 µg
MO-AB-46628W Monoclonal Horse (Equus caballus) WB, ELISA MO46628W 100 µg
MO-AB-65000W Monoclonal Marmoset WB, ELISA MO65000W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset
CloneMO06702FYB
SpecificityThis antibody binds to Zebrafish snrnp40.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. (From NCBI)
Product OverviewMouse Anti-Zebrafish snrnp40 Antibody is a mouse antibody against snrnp40. It can be used for snrnp40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall nuclear ribonucleoprotein 40; U5; snrnp4
UniProt IDQ7ZTY9
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: MIEPKKRVADMAVVPVGVKRPRTELVAAAQSQQLSAMGPPRSSSLQAPIMLLSGHEGEVYCCKFHPNGATLASSGYDRLILMWNVYGDCENYATLKGHSGAVMELHYNTDGSLLFSASTDKTVCVWDSETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTFQNTYQVLSVTFNDTSDQIISGGIDNDIKVWDLRQNKLIYSMQGHGDSVTGLSLSADGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSADGSKIAAGSADRFVYIWDTTTRRIVYKLPGHAGSVNEVAFHPEEPIVLSGSSDKRLYIGEIQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry