Mouse Anti-snrpd3 Antibody (CBMOAB-06724FYB)


Cat: CBMOAB-06724FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06724FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO06724FYB 100 µg
MO-AB-07889H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07889C 100 µg
MO-AB-20677R Monoclonal Cattle (Bos taurus) WB, ELISA MO20677R 100 µg
MO-AB-23963W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23963W 100 µg
MO-AB-29084H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29084C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO06724FYB
SpecificityThis antibody binds to Zebrafish snrpd3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish snrpd3 Antibody is a mouse antibody against snrpd3. It can be used for snrpd3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall nuclear ribonucleoprotein D3 polypeptide; snrpd
UniProt IDQ6IQ56
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNVNCQMANITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNPAAGAGRGKAAILKAQVAARGRGRGGPGRGNVFQKRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry