AibGenesis™ Mouse Anti-SNX31 Antibody (CBMOAB-58689FYA)


Cat: CBMOAB-58689FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58689FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO58689FYA 100 µg
MO-AB-33476W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33476W 100 µg
MO-AB-65064W Monoclonal Marmoset WB, ELISA MO65064W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Marmoset
CloneMO58689FYA
SpecificityThis antibody binds to Rhesus SNX31.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SNX31 Antibody is a mouse antibody against SNX31. It can be used for SNX31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSNX31
UniProt IDF6RIR1
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: MKMHFCIPVSQQRSDALGGRYVLYSVYLDGFLFCRVRYSQLHDWNEQLRRVFGNCLPPFPPKYYLAMTTAMADERRNQLEQYLQNVTMDPNVLRSDVFVEFLKLAQLNTFDITPKKAYLDIFLPNEESINIEIITSDTAERVLEVASHKIGLCRELLGYFGLFLIRFGKEGKLSVVKKLADFELPYASLGSSEVEHCKVGLRKWYMDPSLDSTLMDCRAALDLLYMQAIQDIEKEWAKPTQAQRQKLEAFQKEDNQTKFLELAREVQHYGYLQLDPCTCDYPEPGSGVVLSVGNNEISCCITLPDSQTQDVIFQMSRVKCWQVTFLGTLLDMDGPQRAFNQNLELRFQYSEDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAKNPEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRKSKIKIAKDDCVFGNIKEEDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry