Mouse Anti-Soybean AOC3 Antibody (MO-AB-31033H)


Cat: MO-AB-31033H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max)
CloneMO31033C
SpecificityThis antibody binds to Soybean AOC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the semicarbazide-sensitive amine oxidase family. Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The encoded protein is localized to the cell surface, has adhesive properties as well as monoamine oxidase activity, and may be involved in leukocyte trafficking. Alterations in levels of the encoded protein may be associated with many diseases, including diabetes mellitus. A pseudogene of this gene has been described and is located approximately 9-kb downstream on the same chromosome. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against AOC3. It can be used for AOC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAllene oxide cyclase 3; EC 5.3.99.6; AOC3
UniProt IDF6KBT3
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MASSSSTVALRTISSFSLKPATTTRSLLNTSTSSTITLLPFTSANSFLSKTLKLNTSSPHSHLSLPLNKSFTCRSQAEPSSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAGICVLIQNKSEKKGDMYEAIYSFYFGDYGHISVQGSYLTYEDTYLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELLSKPVEPSPSVEPSPSAKACEPHAVIAGFTD.
For Research Use Only | Not For Clinical Use.
Online Inquiry