Mouse Anti-Soybean Dr1 Antibody (MO-AB-31365H)


Cat: MO-AB-31365H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max)
CloneMO31365C
SpecificityThis antibody binds to Soybean Dr1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a TBP- (TATA box-binding protein) associated phosphoprotein that represses both basal and activated levels of transcription. The encoded protein is phosphorylated in vivo and this phosphorylation affects its interaction with TBP. This protein contains a histone fold motif at the amino terminus, a TBP-binding domain, and a glutamine- and alanine-rich region. The binding of DR1 repressor complexes to TBP-promoter complexes may establish a mechanism in which an altered DNA conformation, together with the formation of higher order complexes, inhibits the assembly of the preinitiation complex and controls the rate of RNA polymerase II transcription.
Product OverviewThis product is a mouse antibody against Dr1. It can be used for Dr1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRepressor protein; Dr1
UniProt IDQ8W0W5
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MEPMDIVGKAKEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCNKEERRTIAPEHVLKALGVLGFGEYIEEVYAAYEQHKLETMQDSLKGAKWSNRAEMTEEEALAEQQRMFAEARARMNGGAIQSKEPEADQSLES.
See other products for " Dr1 "
CBMOAB-22520FYBMouse Anti-Rice Dr1 Antibody (CBMOAB-22520FYB)
MO-AB-25486HMouse Anti-Rat Dr1 Antibody (MO-AB-25486H)
CBMOAB-74087FYAMouse Anti-Zebrafish dr1 Antibody (CBMOAB-74087FYA)
MO-AB-54493WMouse Anti-Marmoset DR1 Antibody (MO-AB-54493W)
MO-AB-11673RMouse Anti-Cattle DR1 Antibody (MO-AB-11673R)
MO-AB-13843WMouse Anti-Chimpanzee DR1 Antibody (MO-AB-13843W)
CBMOAB-27839FYCMouse Anti-Arabidopsis DR1 Antibody (CBMOAB-27839FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry