Mouse Anti-Soybean rps1 Antibody (MO-AB-32488H)


Cat: MO-AB-32488H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max)
CloneMO32488C
SpecificityThis antibody binds to Soybean rps1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for optimal plastid performance in terms of photosynthesis and growth. Required for the translation of plastid mRNAs (PubMed:22900828). Involved in cellular heat stress response and required for heat tolerance. Required for transcriptional activation of HSFA2 and its target genes in response to heat stress. Plays a critical role in biosynthesis of thylakoid membrane proteins encoded by chloroplast genes (PubMed:22570631).
Product OverviewThis product is a mouse antibody against rps1. It can be used for rps1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesS1 ribosomal protein; rps1
UniProt IDA8IFI1
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MMSIYLSRSFPRSNSSLFLCSGKALQSEVLRLGEEMFLVDAGPGTPRICMQDELTGVPINRATRFENKVGFLDLVAGESLIKKKILERFFIDLVAGESLIKERAAARFNDLVGSTDVVAGEPLLLLPRRFRQNLAWMELNKIWRTNTKVKGFIIDKVKKGGYSVAIAGFITFLPFRSHNKRRRKKISNDRFTIESINPKRTNIVVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry