Mouse Anti-SPAG11B Antibody (CBMOAB-58825FYA)


Cat: CBMOAB-58825FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58825FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO58825FYA 100 µg
MO-AB-19576W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19576W 100 µg
MO-AB-29129H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29129C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO58825FYA
SpecificityThis antibody binds to Rhesus SPAG11B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus SPAG11B Antibody is a mouse antibody against SPAG11B. It can be used for SPAG11B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPAG11B
UniProt IDF6SVV9
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MRSHSGAPLFPRSGPTHTAPLHQRSPAACPPTRGAFWLAVLLADMRQRLLPFFTSLLLVALLFPGLSQARHVNHSATEALRELREGATGQGTNRSQLLRHPVKRAPIIRRIPYYPGDVPPGIRNTICLMQQGTCRLFFCHSGEKKRDICSDPWNRCCVSNRDEEGKEKPKTDGRSGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry