Mouse Anti-SPAM1 Antibody (MO-AB-42622W)
Cat: MO-AB-42622W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-42622W | Monoclonal | Guinea pig (Cavia porcellus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO42622W | 100 µg | ||
CBMOAB-58844FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO58844FYA | 100 µg | ||
CBMOAB-07033FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO07033FYB | 100 µg | ||
MO-AB-08496W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08496W | 100 µg | ||
MO-AB-18521W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18521W | 100 µg | ||
MO-AB-33494W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33494W | 100 µg | ||
MO-AB-35750W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35750W | 100 µg | ||
MO-AB-46656W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46656W | 100 µg | ||
MO-AB-65159W | Monoclonal | Marmoset | WB, ELISA | MO65159W | 100 µg | ||
MO-AB-20772R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20772R | 100 µg | ||
MO-AB-07961H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07961C | 100 µg | ||
MO-AB-23758H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23758C | 100 µg | ||
MO-AB-33847H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33847C | 100 µg | ||
MO-AB-06911Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06911Y | 100 µg | ||
MO-AB-10073Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10073Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO42622W |
Specificity | This antibody binds to Guinea pig SPAM1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Guinea pig SPAM1 Antibody is a mouse antibody against SPAM1. It can be used for SPAM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Hyaluronidase PH-20; Hyal-PH20; EC 3.2.1.35; Hyaluronoglucosaminidase PH-20; Sperm adhesion molecule 1; Sperm surface protein PH-20; SPAM1; PH-20 PH20 |
UniProt ID | P23613 |
Protein Refseq | The length of the protein is529 amino acids long. The sequence is show below: MGAFTFKHSFFGSFVECSGVLQTVFIFLLIPCCLADKRAPPLIPNVPLLWVWNAPTEFCIGGTNQPLDMSFFSIVGTPRKNITGQSITLYYVDRLGYYPYIDPHTGAIVHGGLPQLMNLQQHLRKSRQDILFYMPTDSVGLAVIDWEEWRPTWTRNWRPKDIYRNKSIELVKSQHPQYNHSYAVAVAKRDFERTGKAFMLETLKLGKSLRPSSLWGYYLFPDCYNTHFTKPNYDGHCPPIELQRNNDLQWLWNDSTALYPSVYLTSRVRSSQNGALYVRNRVHESIRVSKLMDDKNPLPIYVYIRLVFTDQTTTFLELDDLVHSVGEIVPLGVSGIIIWGSLSLTRSLVSCIGLENYMKGTLLPYLINVTLAAKMCGQVLCKNQGICTRKDWNTNTYLHLNATNFDIELQQNGKFVVHGKPSLEDLQEFSKNFHCSCYTNVACKDRLDVHNVRSVNVCTANNICIDAVLNFPSLDDDDEPPITDDTSQNQDSISDITSSAPPSSHILPKDLSWCLFLLSIFSQHWKYLL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry