AibGenesis™ Mouse Anti-spata4 Antibody (CBMOAB-07054FYB)


Cat: CBMOAB-07054FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07054FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa) WB, ELISA MO07054FYB 100 µg
MO-AB-04118Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04118Y 100 µg
MO-AB-13301Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13301Y 100 µg
MO-AB-20784R Monoclonal Cattle (Bos taurus) WB, ELISA MO20784R 100 µg
MO-AB-30379R Monoclonal Pig (Sus scrofa) WB, ELISA MO30379R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa)
CloneMO07054FYB
SpecificityThis antibody binds to Zebrafish spata4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish spata4 Antibody is a mouse antibody against spata4. It can be used for spata4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpermatogenesis associated 4; spata4; SPATA
UniProt IDQ6DNI1
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MAYSLSPKKAGLPREVLKWLQSLDLSFFPKNVRRDFSNGYLVAEIFSWYFPRDFQMHSFDNGTSLAAKQSNWSQIEKFFVKQNISLVKEMIDGTIHCKPGAAELLVQEIYTILTNRSIQAIQRVEQGFTDKPYQDQLPMVARATASVSIKSNLSLTEVKAEPNIITNQRKVLAIIHRHLEQRKEERVQDPKRFNVKPTLGEQAVRLLAHQHEPNLQMNTSQAAC.
For Research Use Only | Not For Clinical Use.
Online Inquiry