AibGenesis™ Mouse Anti-SPATA48 Antibody (MO-AB-06216W)


Cat: MO-AB-06216W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06216W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO06216W 100 µg
MO-AB-29142H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29142C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO06216W
SpecificityThis antibody binds to Rhesus SPATA48.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPATA48 Antibody is a mouse antibody against SPATA48. It can be used for SPATA48 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpermatogenesis Associated 48; C7orf72; Spermatogenesis-Associated Protein 48; Chromosome 7 Open Reading Frame 72; Uncharacterized Protein C7orf72
UniProt IDG7MLB1
Protein RefseqThe length of the protein is 438 amino acids long.
The sequence is show below: MDVEIQDTPGKISISKRSILSGTVENIDYPHYCDLLRKMNMPFVKGLENRHNYGRFEKKCNPAFLKFHPYPPSVLPDYHLHYPYPPPYGPHYPLFPLRDDVTLGDSCSGFMSPGGDADLNPGIGRTIPTLVDFSDVKPQHRVPRPDTGFQTTIKRQKILSEELQQNRKWNSRGVPDISIRARLGGWTSPLKVTPLQPHHEGRSISHIFTFDEEATCADESEPLVQTNKKCNAKDSFYKSSTQKAYEDVPWDKMLPPKLVPEETTLEKAADPISQCFTLKRYKGLPAITQMVGELWDRFQTRSFLAPVKPVNFVSSSSRSKYIPLYTGHVQSTNADDVDNPLGDIASLAKPRCSKPLYTNTSRAANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVLQKEMAVDLFRHQAPLSRLVTIVKPYNPFNKKDKETIDY.
For Research Use Only | Not For Clinical Use.
Online Inquiry