AibGenesis™ Mouse Anti-SPATA9 Antibody (CBMOAB-58885FYA)


Cat: CBMOAB-58885FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58885FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO58885FYA 100 µg
MO-AB-20792R Monoclonal Cattle (Bos taurus) WB, ELISA MO20792R 100 µg
MO-AB-29143H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29143C 100 µg
MO-AB-30384R Monoclonal Pig (Sus scrofa) WB, ELISA MO30384R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO58885FYA
SpecificityThis antibody binds to Rhesus SPATA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSPATA9 (Spermatogenesis Associated 9) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SPATA9 Antibody is a mouse antibody against SPATA9. It can be used for SPATA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPATA9
UniProt IDF7DA55
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCANAVLEKIKNIFQEEESIRQNREERENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNKIQVLHSVFDQSAEMNEQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry