AibGenesis™ Mouse Anti-SPINK2 Antibody (CBMOAB-58936FYA)


Cat: CBMOAB-58936FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58936FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO58936FYA 100 µg
MO-AB-29157H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29157C 100 µg
MO-AB-65219W Monoclonal Marmoset WB, ELISA MO65219W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO58936FYA
SpecificityThis antibody binds to Rhesus SPINK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the family of serine protease inhibitors of the Kazal type (SPINK). The encoded protein acts as a trypsin and acrosin inhibitor in the genital tract and is localized in the spermatozoa. The protein has been associated with the progression of lymphomas. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus SPINK2 Antibody is a mouse antibody against SPINK2. It can be used for SPINK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine protease inhibitor Kazal-type 2; SPINK2
UniProt IDH9ZCR3
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: MALAVLRLALLLLAVTFAGPLFRRFSKYKTPFCARYQLPGCPRDFNPVCGTDMITYPNECTLCMKIRESGQNIKILRRGPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry