Mouse Anti-SPINK2 Antibody (CBMOAB-58936FYA)
Cat: CBMOAB-58936FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-58936FYA | Monoclonal | Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO58936FYA | 100 µg | ||
| MO-AB-29157H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29157C | 100 µg | ||
| MO-AB-65219W | Monoclonal | Marmoset | WB, ELISA | MO65219W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO58936FYA |
| Specificity | This antibody binds to Rhesus SPINK2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the family of serine protease inhibitors of the Kazal type (SPINK). The encoded protein acts as a trypsin and acrosin inhibitor in the genital tract and is localized in the spermatozoa. The protein has been associated with the progression of lymphomas. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus SPINK2 Antibody is a mouse antibody against SPINK2. It can be used for SPINK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Serine protease inhibitor Kazal-type 2; SPINK2 |
| UniProt ID | H9ZCR3 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MALAVLRLALLLLAVTFAGPLFRRFSKYKTPFCARYQLPGCPRDFNPVCGTDMITYPNECTLCMKIRESGQNIKILRRGPC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry