Mouse Anti-SPINK6 Antibody (MO-AB-20826R)


Cat: MO-AB-20826R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20826R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO20826R 100 µg
Inquiry
MO-AB-29160H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29160C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO20826R
SpecificityThis antibody binds to Cattle SPINK6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against SPINK6. It can be used for SPINK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine protease inhibitor Kazal-type 6; Acrosin inhibitor 2; Acrosin inhibitor IIA; BUSI-II; SPINK6
UniProt IDP01001
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: MKTSGVFLLLSLALFCFFSGVFGQGAQVDCAEFKDPKVYCTRESNPHCGSDGQTYGNKCAFCKAVMKSGGKINLKHRGKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry