AibGenesis™ Mouse Anti-SPPL2B Antibody (CBMOAB-58979FYA)


Cat: CBMOAB-58979FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58979FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO58979FYA 100 µg
MO-AB-06243W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06243W 100 µg
MO-AB-07981H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07981C 100 µg
MO-AB-10496W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10496W 100 µg
MO-AB-65245W Monoclonal Marmoset WB, ELISA MO65245W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO58979FYA
SpecificityThis antibody binds to Rhesus SPPL2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus SPPL2B Antibody is a mouse antibody against SPPL2B. It can be used for SPPL2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPPL2B
UniProt IDF6YRF9
Protein RefseqThe length of the protein is 485 amino acids long.
The sequence is show below: MVHVVSEAGGPRGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPAHGFGNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVALLSYKDMLDIFRRFGRMVRVALYAPHEPVLDYNMVIIFIMAVGTVAIGGYWAGSRDVKKRYMKHKRDDGPEKQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCRIPNNSLPYFHKRPQARMLLLALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKVSAGRGQLICLHEVELASVVPGARGCDSESLTFVLKSRPDVASRAAPAWCGPALALRGVPLKASSREEALGLMSLLCVPPPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELAVFWTGSGFAVNTSLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry