Mouse Anti-srm Antibody (CBMOAB-07329FYB)


Cat: CBMOAB-07329FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07329FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO07329FYB 100 µg
MO-AB-16499W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16499W 100 µg
MO-AB-65327W Monoclonal Marmoset WB, ELISA MO65327W 100 µg
MO-AB-08008H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08008C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO07329FYB
SpecificityThis antibody binds to Zebrafish srm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor.
Product OverviewMouse Anti-Zebrafish srm Antibody is a mouse antibody against srm. It can be used for srm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:63600; srm; zgc:6360
UniProt IDQ7SY20
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MDNIKDGWFTETCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTERDEFSYQEMIANLPLCCHPCPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDAINVSKKYLPGMAKGFFSPKLTLHVGDGFEFMKKNQDAFDIIITDSSDPVGPAESLLKESYYQLMKTALCEGGILCCQGECQWLHLELIKEMRTFCKTLFPVVDYAYCTIPTYPSGQIGFMLCSKNSKTNFREPLRELTRDEIESMSLKYYNPEIHRAAFILPEFARKVLSEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry