Mouse Anti-ssbp1 Antibody (CBMOAB-07438FYB)
Cat: CBMOAB-07438FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-07438FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO07438FYB | 100 µg | ||
MO-AB-01449L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01449L | 100 µg | ||
MO-AB-01686R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01686R | 100 µg | ||
MO-AB-04151Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04151Y | 100 µg | ||
MO-AB-06916Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06916Y | 100 µg | ||
MO-AB-08035H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08035C | 100 µg | ||
MO-AB-08401W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08401W | 100 µg | ||
MO-AB-10098Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10098Y | 100 µg | ||
MO-AB-17266W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17266W | 100 µg | ||
MO-AB-17796Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17796Y | 100 µg | ||
MO-AB-20933R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20933R | 100 µg | ||
MO-AB-29222H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29222C | 100 µg | ||
MO-AB-30455R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30455R | 100 µg | ||
MO-AB-33532W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33532W | 100 µg | ||
MO-AB-33855H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33855C | 100 µg | ||
MO-AB-35761W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35761W | 100 µg | ||
MO-AB-42632W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42632W | 100 µg | ||
MO-AB-46698W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46698W | 100 µg | ||
MO-AB-65388W | Monoclonal | Marmoset | WB, ELISA | MO65388W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO07438FYB |
Specificity | This antibody binds to Zebrafish ssbp1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501]. |
Product Overview | Mouse Anti-Zebrafish ssbp1 Antibody is a mouse antibody against ssbp1. It can be used for ssbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Single-stranded DNA-binding protein; ssbp1; zgc:11032 |
UniProt ID | Q568F8 |
Protein Refseq | The length of the protein is 146 amino acids long. The sequence is show below: MLRYASAQILKQFVRQRTTDASLTLEKSINKVQILGRVGQDPVMRQVEGRNPVTIFSMATNEMWRSGEGEPVGAGDVTQKTTWHRISVFKPGLRDVAYQYVKKGSRIFVEGKLDYGEYVDKNNVRRQATTIIADNIVFLSENLRDQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry