AibGenesis™ Mouse Anti-SSS1 Antibody (CBMOAB-04252CR)


Cat: CBMOAB-04252CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-04252CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans), Rice (Oryza) WB, ELISA MO04252CR 100 µg
Inquiry
CBMOAB-11465HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO11465HB 100 µg
Inquiry
CBMOAB-89562FYB Monoclonal Rice (Oryza) WB, ELISA MO89562FYB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans), Rice (Oryza)
CloneMO04252CR
SpecificityThis antibody binds to Yeast SSS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Yeast SSS1 Antibody is a mouse antibody against SSS1. It can be used for SSS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein transport protein SSS1; Sec61 complex subunit SSS1; Sec61 complex subunit gamma; Ssh1 complex subunit SSS1; Ssh1 complex subunit gamma; SSS1; YDR086C
UniProt IDP35179
Protein RefseqThe length of the protein is 80 amino acids long. The sequence is show below: MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry