Mouse Anti-St2 Antibody (CBMOAB-32069FYA)


Cat: CBMOAB-32069FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32069FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Silkworm (Bombyx mori) WB, ELISA MO32069FYA 100 µg
MO-AB-04158Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04158Y 100 µg
MO-AB-70448W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70448W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Silkworm (Bombyx mori)
CloneMO32069FYA
SpecificityThis antibody binds to fruit fly St2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster St2 Antibody is a mouse antibody against St2. It can be used for St2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG16733; EC 2.8.2.1; MIP25022p1; St2; CG16733-RA
UniProt IDQ9VHH0
Protein RefseqThe length of the protein is 316 amino acids long.
The sequence is show below: MQLIYRELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDEWTERHMRGSGLNFDYV.
For Research Use Only | Not For Clinical Use.
Online Inquiry