Mouse Anti-St3 Antibody (CBMOAB-32074FYA)


Cat: CBMOAB-32074FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32074FYA Monoclonal Fruit fly (Drosophila melanogaster), Silkworm (Bombyx mori), Tomato (Lycopersicon esculentum) WB, ELISA MO32074FYA 100 µg
MO-AB-35326H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO35326C 100 µg
MO-AB-70449W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70449W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Silkworm (Bombyx mori), Tomato (Lycopersicon esculentum)
CloneMO32074FYA
SpecificityThis antibody binds to fruit fly St3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster St3 Antibody is a mouse antibody against St3. It can be used for St3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG5431, isoform A; EC 2.8.2.9; St3
UniProt IDQ9W1L7
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MNRVQVTPRSYPTNLIDKDWGNRKLFYTKDSENFLRLVHDMKLRDDDVWIVTLPKCGTTWMQELLWLLLNNCDFEGALAKDQELRTPFLEFGYSVFHDPNRSFGPIEDLKSPRLIKSHLSLALLPSKLWEGKNKVIYVSRNPLDSYVSRYYHGVSFGFNYGKSLHQYFDEVLASDDFPTEFIEHAHEFYQLRNEPWVFYTSFEMMKKDLRGVINDVSRFLNKPINDQQMEKLLKHLSFAEMKKNPTTNHLWELAQVQHENAGKEMHPFVRRGDVNGYKDELKPEQIEKANVRIQEVLAKNGVTLDELLLLKDHSEVNNSERGEQIKQGQAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry