Mouse Anti-st3gal1 Antibody (CBMOAB-07541FYB)


Cat: CBMOAB-07541FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07541FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Primat, Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa) WB, ELISA MO07541FYB 100 µg
CBMOAB-59161FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59161FYA 100 µg
MO-AB-04160Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04160Y 100 µg
MO-AB-20965R Monoclonal Cattle (Bos taurus) WB, ELISA MO20965R 100 µg
MO-AB-26390W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26390W 100 µg
MO-AB-30461R Monoclonal Pig (Sus scrofa) WB, ELISA MO30461R 100 µg
MO-AB-65426W Monoclonal Marmoset WB, ELISA MO65426W 100 µg
MO-DKB-01096W Polyclonal Human (Homo sapiens), Primat, Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Primat, Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa)
CloneMO07541FYB
SpecificityThis antibody binds to Zebrafish st3gal1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form.
Product OverviewMouse Anti-Zebrafish st3gal1 Antibody is a mouse antibody against st3gal1. It can be used for st3gal1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2,3-sialyltransferase ST3Gal I-r1; st3gal1; siat4-r
UniProt IDQ5TIN9
Protein RefseqThe length of the protein is 321 amino acids long.
The sequence is show below: MFPFSRFPYVTALFSCGIFLLFIFLQNTVIYNSLQTVYSTGGLCACNKCVMDLNDEDWFFIRFNPTVPTLLNRRNSAMRSDVFEWWQGLQSDSQKANFSDVVDILFSLFPDEEHYVVTDPNRCRICAVVGNSGNILGSHYGQLIDSHDFVIRINKGPTKGYETDVGSKTTHRIMYPESAMDLDNSTHLVLLPFKVKDMQWLISVFTTKHITSTYLKVRPTINADREKVMIIHPAFIKYVYESWLRKHGSYPSTGFITLIFALHICDQVSVFGFGAKLDGNWHHYFDESLAHFNRGRHGGDYENRTIHKLLLMNKIALHKGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry