AibGenesis™ Mouse Anti-ST3GAL6 Antibody (CBMOAB-59176FYA)


Cat: CBMOAB-59176FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59176FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO59176FYA 100 µg
MO-AB-04165Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04165Y 100 µg
MO-AB-08063H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08063C 100 µg
MO-AB-20969R Monoclonal Cattle (Bos taurus) WB, ELISA MO20969R 100 µg
MO-AB-22623W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22623W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO59176FYA
SpecificityThis antibody binds to Rhesus ST3GAL6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ST3GAL6 Antibody is a mouse antibody against ST3GAL6. It can be used for ST3GAL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesType 2 lactosamine alpha-2,3-sialyltransferase; ST3GAL6
UniProt IDH9EPG7
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDQFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry