Mouse Anti-st8sia1 Antibody (CBMOAB-07632FYB)


Cat: CBMOAB-07632FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07632FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO07632FYB 100 µg
CBMOAB-59201FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59201FYA 100 µg
MO-AB-20983R Monoclonal Cattle (Bos taurus) WB, ELISA MO20983R 100 µg
MO-AB-65446W Monoclonal Marmoset WB, ELISA MO65446W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rhesus (Macaca mulatta)
CloneMO07632FYB
SpecificityThis antibody binds to Zebrafish st8sia1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish st8sia1 Antibody is a mouse antibody against st8sia1. It can be used for st8sia1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesst8sia1
UniProt IDX1WDY5
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: QYIGGMVSLRCHRSKYIWATLGVLALLWLYIFPVYRIPSDKEMVEEVLRQGQTWSRNQTAVELYSRKLLTDCCNPKRMFAVTKENSPLGKVLWYDGEFYHYHTVTNETYPIFVQDTPLQLPLKRCSVVGNGGVLKHSGCGNEIDRADFIMSRCNLPPLSKDYTDDVGTKTHLVSANPSIIEKSFQNLLWSRKSFVESMKAYGSSYIYIPAFSMKPGTDPSLRAYHALADSSSNQTVLFANPDFLKNVGIFWKNHGVHGKRLSTGLFLVSLALGLCEEVTAYGFWPFSVGLDERPVSHHYYDNILPSSRFHAMPEEFLQLWHLHKSGTLRMRVGSCAKERMELKRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry