Mouse Anti-stard3 Antibody (CBMOAB-07699FYB)


Cat: CBMOAB-07699FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07699FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO07699FYB 100 µg
CBMOAB-59240FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59240FYA 100 µg
MO-AB-08078H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08078C 100 µg
MO-AB-24017W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24017W 100 µg
MO-AB-30474R Monoclonal Pig (Sus scrofa) WB, ELISA MO30474R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO07699FYB
SpecificityThis antibody binds to Zebrafish stard3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSterol-binding protein that mediates cholesterol transport from the endoplasmic reticulum to endosomes. Creates contact site between the endoplasmic reticulum and late endosomes: localizes to late endosome membranes and contacts the endoplasmic reticulum. Acts as a lipid transfer protein that redirects sterol to the endosome at the expense of the cell membrane and favors membrane formation inside endosomes.
Product OverviewMouse Anti-Zebrafish stard3 Antibody is a mouse antibody against stard3. It can be used for stard3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesStAR-related lipid transfer protein 3; MLN64-like protein; START domain-containing protein 3; StARD3; stard3; mln64; NP_571737.
UniProt IDQ9DFS4
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MPSAVDYSELGGSLPAIASLNASYSQASLSLPSPYYCPLPPGERKAFSDVRRTFCLFVTFDLLFITLLWIIELNISKSIWNSLENEVVHYNFKSSFFDIFLLAVFRFLCLQLGYAAFRLRHWWVIAITTLVTTAFLIAKVILSDLFSQNAFGYVLPITSFVVAWLETWFLDFKVLTQEAEDERVYLAAVNAACEPAPLICPRPVSDGQFYSPPESLAGSEDDLDEEGLGRRAVTEQEKAFVRQGREAMAVVEQILTQEENWKFEKTNELGDAVYTLEIPFHGKTFILKGLLQCTAELVYQEVILQPEKMVQWNRTVSVCQILQRVDDNTMVSYDVSAGAAGGVVSPRDFVNVRRVERRRDCYISAGMATNHNSKPHHSRYVRGENGPGGFVVLKSSSNPSVCTFIWVLNTDLKGRLPRYLIHQSLAATMFEFMSHLRQRINEVHVSYR.
For Research Use Only | Not For Clinical Use.
Online Inquiry