Mouse Anti-steap3 Antibody (CBMOAB-07762FYB)


Cat: CBMOAB-07762FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07762FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO07762FYB 100 µg
CBMOAB-59273FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59273FYA 100 µg
MO-AB-06299W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06299W 100 µg
MO-AB-23932W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23932W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO07762FYB
SpecificityThis antibody binds to Zebrafish steap3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish steap3 Antibody is a mouse antibody against steap3. It can be used for steap3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessteap3; si:ch73-250a16.3
UniProt IDE7F9Y0
Protein RefseqThe length of the protein is 481 amino acids long.
The sequence is show below: MADDMTAPLLSDSRDYADDGMLSSPTVAILGSGDFSRSLAVRLVSSRVRVAVGSRCVNRIPSGLFPDAVALMNQEGAAAQAACVVFMALFPEHYGSLLGLRSALAGKVLVDVSNAEVLDIHGPSNAERLAEQFPESLVVKGFNTVSTWELQTGARDGSKQVLICSNSAEGKRKVIQLARHMGFHPLDMGGLSAAREMEVMSLRLFPSWSGPVMLTFLLFLFFYTYGFLRGILLPFILQGHSVFYRLALELVNESLPAVALVTLSLVYLPGLFAAFLQLWRGTKYRRFPPWLDNWLQRRKQLGLLSFLCAALHGVYSVCQPLRRVTQHRLINAAYRQVKAGTEEPWDELAVWRSELYLSCGVLGLGVLSLLAITSVPSVGNTLNWREFTFVQSGLGYVALTLSIMHTLFFGWDFAFHVEAYQFYMPPMFLLAAVLPCAVLLSRCFLLLPCISSRLSRIRRGWESKRNCPVLQHHHLQANGVP.
For Research Use Only | Not For Clinical Use.
Online Inquiry