Mouse Anti-stub1 Antibody (CBMOAB-07912FYB)


Cat: CBMOAB-07912FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07912FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO07912FYB 100 µg
MO-AB-19106W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19106W 100 µg
MO-AB-21077R Monoclonal Cattle (Bos taurus) WB, ELISA MO21077R 100 µg
MO-AB-29268H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29268C 100 µg
MO-AB-65574W Monoclonal Marmoset WB, ELISA MO65574W 100 µg
MO-DKB-01026W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset
CloneMO07912FYB
SpecificityThis antibody binds to Zebrafish stub1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionE3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. Ubiquitinates NOS1 in concert with Hsp70 and Hsp40. Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. Mediates polyubiquitination of DNA polymerase beta (POLB) at ''Lys-41'', ''Lys-61'' and ''Lys-81'', thereby playing a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. Mediates polyubiquitination of CYP3A4.
Product OverviewMouse Anti-Zebrafish stub1 Antibody is a mouse antibody against stub1. It can be used for stub1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesstub1
UniProt IDF1Q8K3
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: MEKMASSPEKSSSAQELKEQGNRLFLSRKYQEAVTCYSKAINRNPSVAVYYTNRALCYVKLQQYDKALADCKHALELDSQSVKAHFFLGQCQLELENYEEAIGNLQRAYNLAKEQRLNFGDDIPSALRIAKKKRWNSIEEKRISQENELHAYLSKLILAEKERELDDRVKQSDDSQNGGDISKMKSKHDKYLMDMDELFSQVDEKRKKREIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQENGWVEDY.
For Research Use Only | Not For Clinical Use.
Online Inquiry