Mouse Anti-stx17 Antibody (CBMOAB-07929FYB)


Cat: CBMOAB-07929FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07929FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07929FYB 100 µg
MO-AB-21080R Monoclonal Cattle (Bos taurus) WB, ELISA MO21080R 100 µg
MO-AB-23496W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23496W 100 µg
MO-AB-65584W Monoclonal Marmoset WB, ELISA MO65584W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07929FYB
SpecificityThis antibody binds to Zebrafish stx17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish stx17 Antibody is a mouse antibody against stx17. It can be used for stx17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesstx17
UniProt IDF1QFP8
Protein RefseqThe length of the protein is 292 amino acids long.
The sequence is show below: MMADEAGKLPLRRLEPPIQKFIKVAIPTDLERLHQHQHNIEKFQRNRQWDKLHHEHINSSRTVQQLRSNLREMEKLCGRVRSVDAEALEKLVQPIRDRASAAIQEFLQIHSDAVNRQNFNEAIATVAETSHSEDDTGVSGSPVTQTQLLLPEIPSEQNAAESWDSLAEDLLQLNGLVNEFSTIVHAQQEKIDSIEANVSIAAANVEEGTQSLGKAARAKLAVLPVAGAVVGGVLGGPLGLLAGFKVAGVAAAFGGGLLGFAGGNLIQRKRKERIDLQLQELHSNNNSKNDTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry