Mouse Anti-stx1b Antibody (CBMOAB-07936FYB)


Cat: CBMOAB-07936FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07936FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human, Rat, Mouse, Hamster, Cow, Pig, Chicken, Zebrafish, Marmoset, Sheep (Ovis aries) WB, ELISA MO07936FYB 100 µg
MO-AB-17820Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17820Y 100 µg
MO-AB-19041W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19041W 100 µg
MO-AB-21085R Monoclonal Cattle (Bos taurus) WB, ELISA MO21085R 100 µg
MO-AB-65587W Monoclonal Marmoset WB, ELISA MO65587W 100 µg
MOFAB-439W Polyclonal Human, Rat, Mouse, Hamster, Cow, Pig, Chicken, Zebrafish WB, IP, ICC, IHC, IHC-P 100 µg
MOFAB-440W Polyclonal Human, Rat, Mouse, Hamster, Cow, Pig, Chicken, Zebrafish WB, IP, ICC, IHC, IHC-P, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human, Rat, Mouse, Hamster, Cow, Pig, Chicken, Zebrafish, Marmoset, Sheep (Ovis aries)
CloneMO07936FYB
SpecificityThis antibody binds to Zebrafish stx1b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish stx1b Antibody is a mouse antibody against stx1b. It can be used for stx1b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSyntaxin 1B; stx1b; syntaxin1
UniProt IDQ9I9P6
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: MKDRTQELRSAKDSDDDEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNTTQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHTEIIKLENSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSQARKKKIMIIICCVILGVVLRSSIGGTLGF.
For Research Use Only | Not For Clinical Use.
Online Inquiry